Protein Info for Xcc-8004.2749.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Cell division protein FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 171 to 199 (29 residues), see Phobius details PF13491: FtsK_4TM" amino acids 30 to 204 (175 residues), 157.3 bits, see alignment E=6.1e-50 PF17854: FtsK_alpha" amino acids 286 to 386 (101 residues), 111 bits, see alignment E=5.8e-36 PF01580: FtsK_SpoIIIE" amino acids 394 to 607 (214 residues), 249.1 bits, see alignment E=7.1e-78 PF09397: FtsK_gamma" amino acids 720 to 780 (61 residues), 93.9 bits, see alignment 7.6e-31

Best Hits

Swiss-Prot: 100% identical to FTSK_XANCP: DNA translocase FtsK (ftsK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to xcb:XC_2213)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7R3 at UniProt or InterPro

Protein Sequence (785 amino acids)

>Xcc-8004.2749.1 Cell division protein FtsK (Xanthomonas campestris pv. campestris strain 8004)
VAKQVPERSKPAEGKSSSRKPAAADTPRRQKLWRDLALIAVAPLLLYLLASLFTYSAADP
GWSQTGSVVAPVHNMGGRVGAWIADVLLQLFGYVAFLLPVVLGAVAWIALFGMDKEGQAE
ADLGPALRLVGMVGFLIASTGFLHLRLFNGDVAGAGGILGRLVSNSLSAGFGALGANLFV
VVLLLVSITLATGLSWFVVMERIGKWVLALGPLLQRKSHQATEWQQTRVMREEREEVRKV
DAVKQAKREPVKIEPPPAPVVEKSERAKRDTQIPMFQGVSTDGSDLPPLALLDDPKPQAK
GYSEETLETLSRQIEFKLKDFRIEAQVVGAYPGPVITRFEIEPAPGVKVSQISSLDKDIA
RGLSVKSVRVVDVIPGKSVVGLEIPNVTREMIFLSELLRSKEYDKSASPLTLALGKDIAG
RPTVADLARMPHLLVAGTTGSGKSVAVNAMVLSLLFKASHKELRMLMIDPKMLELSVYQG
IPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLAGFNKKVKDAEDAGQPMMD
PLFKPNPELGEAPRPLETLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLIL
ATQRPSVDVITGLIKANIPTRVAFQVSSKIDSRTILDQSGAEALLGNGDMLYLPPGTALP
DRVHGAFVSDEEVHRVVEHLKASGPVAYVDGVLDEVQTMGDGTVVGATGLPESSGGGGDE
SDPLYDEALRIVTETRRASISGVQRRLKIGYNRAARLIEAMEAAGVVSPPEHNGDRTVLA
PPPPK