Protein Info for Xcc-8004.2747.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Outer membrane lipoprotein carrier protein LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 5 to 204 (200 residues), 75.9 bits, see alignment E=1.5e-25 PF03548: LolA" amino acids 33 to 197 (165 residues), 184.5 bits, see alignment E=1.3e-58

Best Hits

Swiss-Prot: 100% identical to LOLA_XANCP: Outer-membrane lipoprotein carrier protein (lolA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 100% identity to xcc:XCC1974)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UUK7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Xcc-8004.2747.1 Outer membrane lipoprotein carrier protein LolA (Xanthomonas campestris pv. campestris strain 8004)
MHRQLRYAVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKENSSGRV
ALATPRQFRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPTRL
DKQYDVSEEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTAISF
SGWKRNPAFAADTFRYTPGKGVDVVGDAQ