Protein Info for Xcc-8004.2737.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 19 to 383 (365 residues), 441.2 bits, see alignment E=1.2e-136 PF21016: RlmN_N" amino acids 24 to 83 (60 residues), 95.6 bits, see alignment E=1.2e-31 PF04055: Radical_SAM" amino acids 129 to 299 (171 residues), 61.3 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 100% identical to RLMN_XANC8: Dual-specificity RNA methyltransferase RlmN (rlmN) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 100% identity to xcb:XC_2202)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UUL5 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Xcc-8004.2737.1 Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-) (Xanthomonas campestris pv. campestris strain 8004)
VNEVVIPSVLLDVPVSAAPVHKQNLLDLDREGLEHFFADTLGEARYRAHQVMKWIHHRYV
TDFDQMTDLGKALRAKLHQHAEVLVPNVVFDKPSTDGTHKWLLAMGTDGKNAIETVYIPD
KGRGTLCVSSQVGCGLNCTFCSTATQGFNRNLTTAEIIGQVWVAARHLGNVPHQQRRLTN
VVMMGMGEPLMNFDNVVRAMSVMRDDLGYGLASKRVTLSTSGLVPMIDRLATESDVSLAV
SLHAANDVLRESLVPLNKKYPIAELMESCARYLRGNKKRDSVTFEYTLMKGINDQPEHAR
QLARLMRQFDNAVQSKDAGKVNLIPFNPFPGTRYERSGETEIRAFQKILLDAQVLTMVRR
TRGDDIDAACGQLKGQVMDRTRRQAEFRRTLEGQADRDAAA