Protein Info for Xcc-8004.2732.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 434 (432 residues), 549.9 bits, see alignment E=7e-169 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 100.2 bits, see alignment E=4.9e-32 amino acids 180 to 298 (119 residues), 93.5 bits, see alignment E=5.8e-30 TIGR00231: small GTP-binding protein domain" amino acids 5 to 159 (155 residues), 85.4 bits, see alignment E=5.5e-28 amino acids 179 to 344 (166 residues), 89.8 bits, see alignment E=2.5e-29 PF02421: FeoB_N" amino acids 5 to 158 (154 residues), 54.8 bits, see alignment E=5e-18 amino acids 180 to 344 (165 residues), 50 bits, see alignment E=1.4e-16 PF00009: GTP_EFTU" amino acids 78 to 164 (87 residues), 26.8 bits, see alignment E=2.3e-09 amino acids 179 to 346 (168 residues), 49.1 bits, see alignment E=3.2e-16 PF14714: KH_dom-like" amino acids 356 to 434 (79 residues), 87.6 bits, see alignment E=3.2e-28

Best Hits

Swiss-Prot: 100% identical to DER_XANC8: GTPase Der (der) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to xca:xccb100_2287)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UUM0 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Xcc-8004.2732.1 GTP-binding protein EngA (Xanthomonas campestris pv. campestris strain 8004)
MLPLVALVGRPNVGKSTIFNALTRTRDALVHDQPGVTRDRNYGVCRLDEQQPFIVVDTGG
IAGDEEGLAGATARQARAAAGEADLVLFVVDGREGASSLDDEILAWLRKLARPTVLVINK
IDGTDEESVRSEFSRYGFSDVVALSAAHRQGIDDLLEEVGARLPEEGAGELLDNDPARVR
IAFVGRPNVGKSTLVNRLLGEERMIASEVPGTTRDSIAVDLERDGRQYRLIDTAGLRRRG
KVEEAVEKFSAFKTLQAIEQCQVAVLMLDATEGVTDQDATILGAILDAGRALVVAINKWD
GQSDYQRAQAEDLLSRKLGFVNWAEAVRISALHGSGMRELFQAIHRAHASATHEFSTSEV
NQALEIAYETNPPPSIRGHVSKLRYVHPGGANPPTFIVHGTRLKVLPESYKRYLENFFRK
RFKLVGTPVRFIFREGANPYEGKKNPLSDRQIARKRRLMRHVKGK