Protein Info for Xcc-8004.271.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 7 to 95 (89 residues), 22.2 bits, E=4.5e-08
• PF01210: NAD_Gly3P_dh_N
  • amino acids 7 to 163 (157 residues), 183.9 bits, E=5.4e-58
• PF02558: ApbA
  • amino acids 8 to 103 (96 residues), 24.8 bits, E=3.7e-09
• PF07479: NAD_Gly3P_dh_C
  • amino acids 183 to 321 (139 residues), 174.8 bits, E=3e-55
• PF20618: GPD_NAD_C_bact
  • amino acids 243 to 309 (67 residues), 81.4 bits, E=1.4e-26

Best Hits

Swiss-Prot: 100% identical to GPDA_XANCP: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to xca:xccb100_0225)

MetaCyc: 48% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See Q4V072 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Xcc-8004.271.1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (Xanthomonas campestris pv. campestris strain 8004)
MSDPTQKIAVLGAGSWGTALAALVARHGHPTVLWGRDAAMVDAIDRTHENPRYLPGIALP
DSLRATTDLQQTIAGASWILVVVPSHAFTETIKLLAPLRPAGAGIAWATKGFEPGSGRFL
HEVARDILGPSVPLAVVTGPSFAKEVTLGLPTAITVHGDDAAFAQVVADAMHGPTFRAYT
GDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGLNEMLRLAAVIGARPETLM
GLAGLGDLVLTCTGDLSRNRRLGLALGRGQSLSDAIREIGQVVESVQTADEVMRQAEQHG
IELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLFT