Protein Info for Xcc-8004.263.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Distant homolog of E. coli HemX protein in Xanthomonadaceae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF04375: HemX" amino acids 116 to 322 (207 residues), 42.2 bits, see alignment E=4e-15

Best Hits

KEGG orthology group: K02496, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 100% identity to xcc:XCC0197)

Predicted SEED Role

"Distant homolog of E. coli HemX protein in Xanthomonadaceae" in subsystem Heme and Siroheme Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X2K5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Xcc-8004.263.1 Distant homolog of E. coli HemX protein in Xanthomonadaceae (Xanthomonas campestris pv. campestris strain 8004)
MTDMPAPARRFPLAWLLLVVAIVAVGVALFLGWRAWQSYQDTQIQAAQAQQQRWDGTQQL
LDTLRRDQRLANERLQDAAATNRVLRDEMLGLSQRSALLEDTVQKLADPNRHGAQALRLD
EVELLLRLGQQRLSIAGDADGARRAYALANGALNGIDDPGYLNLRQALVQERDALDRLGP
GPQAQVGEGLDRLATDLQRLPEQSAQDSEAALPWWQKALSPLVEIRPSRGDALITGGERT
AACDALQIEVSLARAAAERGDAQGFAHALRRVDTWTTRLWPDSPQRRQARTRLRELQQAP
LRPRLPELGTTLLQLQAMREGRSTQ