Protein Info for Xcc-8004.2619.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 21 to 110 (90 residues), 101.7 bits, E=1e-33

Best Hits

Swiss-Prot: 100% identical to PHS_XANC8: Putative pterin-4-alpha-carbinolamine dehydratase (XC_2102) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 96% identity to xom:XOO_2920)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• L-phenylalanine degradation V (2/3 steps found)
• tetrahydropteridine recycling (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

See Q4UUW5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Xcc-8004.2619.1 Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (Xanthomonas campestris pv. campestris strain 8004)
MTDLIPLEQAHCLPRKGSDHKLGEARLAELLPQVPGWELAEAGMAITRTFRFADYYRTLA
FVNALAWIAHREDHHPDLGVHYDRVVVRYSTHDVGGLSENDFICAAKVAQLFDQGITA