Protein Info for Xcc-8004.2448.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR01198: 6-phosphogluconolactonase" amino acids 15 to 228 (214 residues), 133 bits, see alignment E=6.1e-43 PF01182: Glucosamine_iso" amino acids 16 to 226 (211 residues), 143.8 bits, see alignment E=3.9e-46

Best Hits

Swiss-Prot: 65% identical to 6PGL_XYLFA: 6-phosphogluconolactonase (pgl) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 100% identity to xcc:XCC2138)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6V1 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Xcc-8004.2448.1 6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type (Xanthomonas campestris pv. campestris strain 8004)
MSLQDNDRISLVRYDDLDEWTEAVASEMADLLEQEISRRGQARMLLSGGTTPAPVYESLA
HRPLDWSRVEVGLVDERWLSPQDQDSNAWLVKQSFLDHAPAATFIPLVRPGKQLPECVHT
ANLQATHAEPACLAVMGMGGDGHTASLFPGSTDLPKALASPQPYASLDATGCPGANQWPL
RITLTPAGLAPIPTRLLLLRGKQKLDVLQAALAGEDISEYPIRVALQQPGPRLRVHWCS