Protein Info for Xcc-8004.2426.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Transcription accessory protein (S1 RNA-binding domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 PF09371: Tex_N" amino acids 9 to 81 (73 residues), 99.9 bits, see alignment E=2.2e-32 PF22706: Tex_central_region" amino acids 137 to 313 (177 residues), 228.2 bits, see alignment E=2.8e-71 PF16921: Tex_YqgF" amino acids 329 to 455 (127 residues), 184.1 bits, see alignment E=5.2e-58 PF14635: HHH_7" amino acids 473 to 560 (88 residues), 33.3 bits, see alignment E=2.1e-11 PF12836: HHH_3" amino acids 495 to 559 (65 residues), 101 bits, see alignment E=1.2e-32 PF17674: HHH_9" amino acids 565 to 634 (70 residues), 77.1 bits, see alignment E=6.1e-25 PF23459: S1_RRP5" amino acids 652 to 717 (66 residues), 27.3 bits, see alignment E=1.8e-09 PF00575: S1" amino acids 653 to 724 (72 residues), 75 bits, see alignment E=2e-24

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to xcc:XCC2154)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8R3 at UniProt or InterPro

Protein Sequence (787 amino acids)

>Xcc-8004.2426.1 Transcription accessory protein (S1 RNA-binding domain) (Xanthomonas campestris pv. campestris strain 8004)
MHDTQLAQQIARTIADEIGAQPAQARAAIALLDEGASVPFIARYRKEVTGGLDDTQLRNL
ETRLTYLRELEDRRAAILSSIGEQGKLSDELRSEIVAADTKSRLEDLYLPYKPKRRTRAQ
IAREAGLEPLADTLLADPTQAPDTTAAIYVDADKGVADVKAALEGARAILMERWGEDAAL
VGELRSWLNDNGVIRARVAEGKEEAGAKYRDYFDHAESLARIPSHRLLALFRARREEFLY
LDLDPGTDADAGHQYAEGRVARSAGISNEGRPADRWLLDACRLTWRAKLHMHLLLDLFNQ
AREKAEAEAIAVFGDNLKDLMLAAPAGPRVVLGLDPGIRTGCKIAVVDATGKLVATETIY
PHEPKRQWDQSLQTLKKLCLQHNVELIAIGNGTASRETDKLAGEAIALCDRAKLQKIVVS
EAGASVYSASEFAAKEFPNLDVSLRGAVSIARRLQDPLAELVKIEPKAIGVGQYQHDVDQ
YRLAKALDARVEDCVNAVGVYVNTASAALLSRVSGLSSTVAENIVRHRDDNGPFKRRKDL
LKVPRLGDKTFEQCAGFLRIADGDEPLDVSAVHPEAYPVVERIVSSTGKPIKALLGDGSF
LRALKPEQFTDEQFGVPTVRDILKEMEKPGRDPRPEFKAAQFAEGIEDIKHLKPGMILEG
VVSNVAAFGAFVDIGVHQDGLVHISALSDTFVKDPRDVVKAGDIVKVKVLEVDVARKRIA
LTRRLSDTPPPADAAAQSRDTRGAGQGRRDGSGGGGRGPAAGTAKPRTSAPPANNALADA
FARAKRS