Protein Info for Xcc-8004.2411.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 40 to 70 (31 residues), 23 bits, see alignment (E = 1.2e-08) PF21088: MS_channel_1st" amino acids 80 to 120 (41 residues), 35 bits, see alignment 2.3e-12 PF00924: MS_channel_2nd" amino acids 121 to 187 (67 residues), 69.2 bits, see alignment E=5.3e-23 PF21082: MS_channel_3rd" amino acids 195 to 276 (82 residues), 40.5 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC2167)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8S9 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Xcc-8004.2411.1 Small-conductance mechanosensitive channel (Xanthomonas campestris pv. campestris strain 8004)
MVGGVLAAAAGAAAAKPAAAKSPAFDWSNLNWAEYALNCGLALLILVVGMWLAKQLSQWL
HRALTRARVEITLANFLRNVSYALLLVLVFVSALSKIGVPPTSLIAVLGAAGLAVGLALK
DSLSNIAAGVMLIVLRPMRDGDHVVIAGQEGIVDEIRIFQTRIKAFDERMITLPNSTITT
APIINYSTLPTRRLEVTVGVGYGDDLKKAQQLLLQIAKDNPNVLDTPAPFVQVTNLGEST
VDLMLFAYASNGNFGAAKSTTLEQIRDQLLENGLSIPYPQRDLHVYHHDADGKPIAELLR
KGVTDDGDLTKGPPLAR