Protein Info for Xcc-8004.2408.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Mn-dependent transcriptional regulator MntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF01325: Fe_dep_repress" amino acids 36 to 90 (55 residues), 46.2 bits, see alignment E=1.5e-15 PF13412: HTH_24" amino acids 46 to 82 (37 residues), 27.5 bits, see alignment 6.6e-10 PF12802: MarR_2" amino acids 49 to 86 (38 residues), 29.9 bits, see alignment E=1.7e-10 PF09339: HTH_IclR" amino acids 51 to 86 (36 residues), 27.8 bits, see alignment 6.1e-10 PF01047: MarR" amino acids 51 to 82 (32 residues), 27.7 bits, see alignment 7.3e-10 PF02742: Fe_dep_repr_C" amino acids 93 to 148 (56 residues), 48.9 bits, see alignment E=2e-16

Best Hits

Swiss-Prot: 65% identical to MNTR_SALTI: Transcriptional regulator MntR (mntR) from Salmonella typhi

KEGG orthology group: K11924, DtxR family transcriptional regulator, manganese transport regulator (inferred from 99% identity to xca:xccb100_2011)

Predicted SEED Role

"Mn-dependent transcriptional regulator MntR" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6T4 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Xcc-8004.2408.1 Mn-dependent transcriptional regulator MntR (Xanthomonas campestris pv. campestris strain 8004)
VGKSEKLDASAPVLIDAQVHMESFRQVREARRAELVEDYVELISDLLVDGGEARQVDIAA
RLGVAQPTVAKMLKRLVRDGWVVQRPYRGVFLTPAGEALAASSRQRHQIVERFLLALGID
EATARRDAEGIEHHVSEATVAAFAAFLERQGNSTP