Protein Info for Xcc-8004.229.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Malate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 52 (17 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 6 to 296 (291 residues), 87.7 bits, see alignment E=6.2e-29 PF01758: SBF" amino acids 198 to 303 (106 residues), 25 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to xca:xccb100_0191)

Predicted SEED Role

"Malate permease" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X2I8 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Xcc-8004.229.1 Malate permease (Xanthomonas campestris pv. campestris strain 8004)
MAVDAFALILAMLGLGLVFARLRVLPDNSADVLNRIVLYICLPASVLTYVPRLHLDASLG
GVIATPWLLTALIVPMLWGCSRLLGVPRDEYAALLMCVVFTNSSFIGFPMVRALIGDHAL
PYAVVYDQFGTFVLLSTFGLYVLARYSGDTPPTARMILARVLRFPPLWALVFALTLMPEQ
PPAWIGSGLKSLADAMLPLVMLAVGFSLQLRLPAQELKPLALGLLFKLAVMPVLALPLSW
ALGLQGQMLQTNVLESAMPTMITAAALAISHRLAPRLAAAMVGYSILLSLLTLPAWAWLL
ARLAA