Protein Info for Xcc-8004.2194.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Formate dehydrogenase chain D (EC 1.2.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 30 to 272 (243 residues), 221.7 bits, E=4.5e-70
• PF02634: FdhD-NarQ
  • amino acids 34 to 271 (238 residues), 262.3 bits, E=2.4e-82

Best Hits

Swiss-Prot: 100% identical to FDHD_XANCB: Sulfur carrier protein FdhD (fdhD) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to xca:xccb100_1817)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See Q4UVU9 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Xcc-8004.2194.1 Formate dehydrogenase chain D (EC 1.2.1.2) (Xanthomonas campestris pv. campestris strain 8004)
MTGQPSTPVRPGSVVRTVRRHRGGRSATVQDMVAAEMPVAFNYNGVPFAVMMATPEDLED
FALGFSLSEGIVDHPQDLRVVAVDTFLEGASLQIEIPPERAAALDQRRRNLDGRSGCGVC
GNESIEAVLRVPPVLQSALRIDVDALARALDALHARQPIAAQTGAVHAAGWADAQGMVQL
VREDVGRHNALDKLIGALARARVDATQGFAVVTSRASYEMAMKAAQARIPLLAAISAPTA
LAISLADSAGLTLIGFARDHDCVVYSHPQRLDLGVAVGEPA