Protein Info for Xcc-8004.2184.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 57 to 180 (124 residues), 28.5 bits, see alignment E=1.9e-10 PF00165: HTH_AraC" amino acids 230 to 270 (41 residues), 30 bits, see alignment 6.6e-11 amino acids 282 to 321 (40 residues), 30.2 bits, see alignment 5.8e-11 PF12833: HTH_18" amino acids 243 to 322 (80 residues), 80.4 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC2364)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X872 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Xcc-8004.2184.1 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Xanthomonas campestris pv. campestris strain 8004)
MRAQRSVPPSPAPISVVVVAPAGISPFHLSVPMMIFDLQPDDRPLFTLRIAAEDTRVALA
GGQVGVTPDGDLSLLDQAEVLIVPGWADLDRAPSAALRAALVAATQRGAHVVGLCYGAYA
LAYAGLLDGKLASTHWHAEADFHHRFPRVRLDMNALYVDEQRIVTSAGTGAALDCCMYLV
RKLCGARQANAIARMMVLPQHRDGGQAQYIDQPVPASPQDAALSRLLDFMRADLQQDHAL
DALAERVAMSRRSFTRRFHKATGMTVGEWLGAERLRRAKDLLESTALSIEQVAEQSGYKS
AVSFRQRFNQAFQTSPREWRKRFTLLEQESLRV