Protein Info for Xcc-8004.2180.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: RND efflux system, membrane fusion protein CmeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 35 to 367 (333 residues), 252.9 bits, see alignment E=2e-79 PF16576: HlyD_D23" amino acids 59 to 289 (231 residues), 41.5 bits, see alignment E=1.9e-14 PF13533: Biotin_lipoyl_2" amino acids 62 to 108 (47 residues), 29.7 bits, see alignment 8.5e-11 PF13437: HlyD_3" amino acids 171 to 286 (116 residues), 27.6 bits, see alignment E=8.1e-10 PF00529: CusB_dom_1" amino acids 299 to 356 (58 residues), 27.8 bits, see alignment E=4.1e-10

Best Hits

Swiss-Prot: 40% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to xcb:XC_1748)

MetaCyc: 40% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6J1 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Xcc-8004.2180.1 RND efflux system, membrane fusion protein CmeA (Xanthomonas campestris pv. campestris strain 8004)
MIAPLRTFGLACAITVALAACSKPEQQQAPPPPEVSVLEMKPQTLPLERDLVGRLSAFRS
ADVRARVDGVLLKRLYTEGTDVKEGQPLFEIDPMPLRATLLQAQGQLAAAEATYANAKIA
AQRARSLAPQQYVSRADIDTAEATERSSGASVQQARGVVESASIQLSFASVTSPITGRAG
IQRVTEGALVGSGEATLLTTVDQIDPLYVNFAMSSEELAALRQAQSSGNVQLSGDGKSTI
NVELGNGTQYPHPGTLDVSAVTVDPSTGAVSLRATLPNPEMALLPGAFVTFKASLGQRNN
AYLVPQQALQRDATGAYALVLGKDGKVVRKNLTVDGQQKGQWIVTAGMAPGDQVIVDGVQ
KAKEGQPAKGVPWDPNKPAQGGQPGAPGAAPAGGQAGTGQGAPAGAGKGDAGGPAGGEQP
KSDDAGQPSDSQSKQQ