Protein Info for Xcc-8004.213.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Putative OMR family iron-siderophore receptor precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07715: Plug" amino acids 69 to 164 (96 residues), 59.7 bits, see alignment E=3.8e-20 TIGR01783: TonB-dependent siderophore receptor" amino acids 71 to 739 (669 residues), 291.4 bits, see alignment E=8.6e-91 PF00593: TonB_dep_Rec" amino acids 252 to 713 (462 residues), 153.2 bits, see alignment E=2.1e-48

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to xcc:XCC0158)

Predicted SEED Role

"Putative OMR family iron-siderophore receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X2N5 at UniProt or InterPro

Protein Sequence (742 amino acids)

>Xcc-8004.213.1 Putative OMR family iron-siderophore receptor precursor (Xanthomonas campestris pv. campestris strain 8004)
MPAKTLPLATLSAALLCALTMTPAAARAADLADANADADANAKTLDAVSVNGTVSRAQPA
TTTRLPLTLQETPQSVSVIGLQRLEDESLFSIDDVMRNVTGVNVSFYDTQRPLYFARGFQ
ITDFQVDGLPTYSGATNQEYDTVFYDRIEVIRGANGLLTGAGIPSATVNLLRKRPGKEFD
ASFAVSAGTWDFRRMQADVNAPLTSDGRWRSRVVAAWQDRDYYYDRYHDTKMSGMAVLEG
DLTESTTLTVGYQRQDNTPVGSTWGTVPFFAADGTLANLSRSTNLAPEWTRWQRETSTAF
ANLEQRIGEDWLLRVNAAHTKGNVQSLRVYGTGYPAADGSGMFLRTGVGETEDTRDSVDV
YLSGGFSLFGRQHDVVVGGSWQDLQSTSYGLAQTYPDDWATCPNAFGPPERCYFIPNIRN
WDGNASEVTYARNGRRSEGRTTQRGVYASTRFRLADPLSLIAGARLSSWETRTQAFDASG
AYTGTSGRYEVSDEVTPYVGLVYDIVPDVSVYASYTEIFNPQNYRDKDNNLLAPVEGSNL
EAGIKAQLLDGHAMATAAVFEAKQDNFAVRDMTQPESSLPDGNSAYIGINGTKSRGWEMD
INGEILPGWTVNAGFTHVKVTRPPTDAIYANLPEDYLQLSTQLRLPGAWERLSIGGGVSW
QSAVRGFNIARPTGDGSGATTPVTVVQNPYALVHFNANYRISEQWTATLAVRNAFDKTYW
ANLDYQNYGEPRFVSVSLRWRY