Protein Info for Xcc-8004.2104.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Acyl-CoA dehydrogenase (EC 1.3.8.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF12418: AcylCoA_DH_N" amino acids 3 to 34 (32 residues), 35.4 bits, see alignment (E = 3.2e-12) PF02771: Acyl-CoA_dh_N" amino acids 81 to 158 (78 residues), 25 bits, see alignment E=7.2e-09 PF02770: Acyl-CoA_dh_M" amino acids 164 to 272 (109 residues), 41.8 bits, see alignment E=3.6e-14 PF00441: Acyl-CoA_dh_1" amino acids 284 to 451 (168 residues), 82.4 bits, see alignment E=1.4e-26 PF22924: ACOX_C_alpha1" amino acids 292 to 445 (154 residues), 36.3 bits, see alignment E=1.7e-12 PF08028: Acyl-CoA_dh_2" amino acids 300 to 444 (145 residues), 26.7 bits, see alignment E=2.2e-09 PF12806: Acyl-CoA_dh_C" amino acids 468 to 589 (122 residues), 103.7 bits, see alignment E=2.7e-33

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to xcb:XC_1680)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6C9 at UniProt or InterPro

Protein Sequence (597 amino acids)

>Xcc-8004.2104.1 Acyl-CoA dehydrogenase (EC 1.3.8.7) (Xanthomonas campestris pv. campestris strain 8004)
MSSYIAPLTDFRFGLYDVLGAEALFARLGYTDASADIVDAVLEEAGRFTAQVLAPLNSIG
DEIGCAFDKSTHAVTTPPGFRAAYDQFVEGGWNGLTAEPQFGGQGMPHTLGVPLSEMINA
ANLAWGNFPLLSHGAMEALRQHGEAWQQEVFLKPLIDGRWTGTMCLTEPHCGTDLGLLKT
RAEPNADGSYAITGTKIFITAGEHDLTDNIVHLVLAKLPDAPAGAKGISLFVTPKFKVDR
DGTVGERNALHCGSIEHKMGIKGSVTCVMNFEGAQGYLVGLPHKGLQAMFTMMNTARLSV
GLQGIGLSERAYQNALRYTRERLQSRAISGAKFPDKPADPIIVHPDVRRMLLTIKALTEG
SRLLALHAASLVDVAHRGGSEQERADAETLVSFLTPISKACQTEWSVENTYHALQCFGGH
GYIREYGMEQLARDARITTIYEGTTGIQALDLIGRKTASSQAAGLKLFLADVETFANTHA
DNAALAEFIKPLRDKASEWAMLTRDVLDRAARNPDELGAASYDYLFYSGYVVLAYWWARS
VAAADASAHGEEFKRAKRETARFYFARILPRTLTHAATIRSGAAPLMTLEAELFWQG