Protein Info for Xcc-8004.209.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: rhamnogalacturonan acetylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 23 to 217 (195 residues), 48.1 bits, see alignment E=3.4e-16 PF13472: Lipase_GDSL_2" amino acids 27 to 213 (187 residues), 59.6 bits, see alignment E=1.2e-19 PF07883: Cupin_2" amino acids 301 to 365 (65 residues), 55.1 bits, see alignment E=1e-18 PF02311: AraC_binding" amino acids 308 to 366 (59 residues), 38.1 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_0163)

Predicted SEED Role

"rhamnogalacturonan acetylesterase" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X427 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Xcc-8004.209.1 rhamnogalacturonan acetylesterase (Xanthomonas campestris pv. campestris strain 8004)
MRRLLIAMLLLCAHVAHAAPHRIFIAGDSTAAEYGSDRAPQAGWGQMLQGWFDPAQWQVH
SHAKGGRSTRSFIAEGRLDAIAKDIRAGDVLLIQFGHNDAKREDATRYTDPQGDYQQFLR
RFIAIARDKGATPILITPAARLLYDFGALPDTHGRYTLAMQQLAAQEQVGLIDLNASSSD
WIRALGEQAAKPYFLFVPEQTKADGTHFSQAGATAIACLVVHGWVQLQPALKPQLRRDAD
CGAAPDTAARRAAQAHPSLVVHERDLPRSQPGPHGGAGPTTAYPFFADAPELKFVLRKRV
LHKGAGIGLHLHDKDEIYYVVSGRGLYALDGKQYEVAAGDALLTRPGSTHALQQVGEEDL
VILLTYLAARS