Protein Info for Xcc-8004.2034.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 TIGR00631: excinuclease ABC subunit B" amino acids 4 to 668 (665 residues), 1060.8 bits, see alignment E=0 PF04851: ResIII" amino acids 16 to 92 (77 residues), 42.9 bits, see alignment E=1.5e-14 PF17757: UvrB_inter" amino acids 160 to 249 (90 residues), 106.2 bits, see alignment E=2.3e-34 PF00271: Helicase_C" amino acids 435 to 545 (111 residues), 72.9 bits, see alignment E=7.5e-24 PF12344: UvrB" amino acids 552 to 593 (42 residues), 79.1 bits, see alignment 5.1e-26 PF02151: UVR" amino acids 637 to 669 (33 residues), 36.4 bits, see alignment (E = 9.2e-13)

Best Hits

Swiss-Prot: 100% identical to UVRB_XANCP: UvrABC system protein B (uvrB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to xcb:XC_1628)

MetaCyc: 70% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UW79 at UniProt or InterPro

Protein Sequence (673 amino acids)

>Xcc-8004.2034.1 Excinuclease ABC subunit B (Xanthomonas campestris pv. campestris strain 8004)
MTDRFELVSPYSPAGDQPAAIDKLVANFEAGLAKQTLLGVTGSGKTYTIANVVQQVQKPT
LVMAPNKTLAAQLYGEFKSFFPNNAVEYFVSYYDYYQPEAYVPSSDTFIEKDSSINEHIE
QMRLSATKTLLSRRDSLVVATVSAIYGLGAPEDYLSLRLILSIGEHIDQRQLIRHLTDLQ
YTRNEFELTRGAFRVRGEVLDVFPAESDTEALRIELFDGDIEQLTLFDPLTGETLRKLQR
YTVYPKTHYATTRERTLSAVDTIKEELKERLEQLYSQNKLVEAQRLAQRTQFDLEMMAEV
GFCNGIENYSRHLTGKAPGEPPPTLFDYLPPDALLVIDESHVTIPQIGAMYKGDRSRKET
LVEFGFRLPSALDNRPLRFEEWEARSPRSIYVSATPGPYELRESAGEITELVVRPTGLID
PVVEIRPVGTQVDDLMSEVHERIKLGDRVLVTTLTKRMAENLTEYLGEHGIRVRYLHSDI
DTVERVEIIRDLRLGKFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSTGSLIQTIG
RAARNLRGKAILYADKMTRSMQAAIDETDRRREKQVEYNLEHGITPKSVARPISDIMEGA
REDAAEKKAGKGRSKSRQVAEEPADYRAMGPAEIAGKLKALEQKMYQHAKDLEFEAAAQI
RDQILKLKAASLA