Protein Info for Xcc-8004.202.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details PF04290: DctQ" amino acids 37 to 165 (129 residues), 91.4 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_0164)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>Xcc-8004.202.1 TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter (Xanthomonas campestris pv. campestris strain 8004)
MTEPASVNVPVAPLQRALDRVSNVAISVAAIALLGLVVVQGWQVFTRYVLNDSPSWTEPV
TLLLLSTALSLAAAAGVHTNRHFGFYLLGEHMPPLVRRVFDVIRPVMIIAIGAVLAWWSA
VLLLDGLDIKMAGAQMPQSINYLPLSIGGALMVVFALYKLWRVLRPIHTGGVR