Protein Info for Xcc-8004.1984.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to NUOB_XANC8: NADH-quinone oxidoreductase subunit B (nuoB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 93% identity to xfa:XF0306)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
Fe(II) oxidation (3/6 steps found)
NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UWB7 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Xcc-8004.1984.1 NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3) (Xanthomonas campestris pv. campestris strain 8004)
MGVIQTLDRLMTNPMPEGRVEDILRPEGENPLLEKGYVTTSVDALLNWARTGSMWPMTFG
LACCAVEMMHAGAARLDLDRYGVVFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMPDPK
WVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGILQLQKKIWRTQ
TIAR