Protein Info for Xcc-8004.1929.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF10609: ParA" amino acids 22 to 263 (242 residues), 344.8 bits, see alignment E=7e-107 PF13614: AAA_31" amino acids 24 to 62 (39 residues), 37.1 bits, see alignment 8.3e-13 PF09140: MipZ" amino acids 25 to 70 (46 residues), 34.2 bits, see alignment 4.3e-12 PF01656: CbiA" amino acids 26 to 244 (219 residues), 52 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 63% identical to APBC_PSEFR: Iron-sulfur cluster carrier protein from Pseudomonas fragi

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to xcb:XC_1547)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7R8 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Xcc-8004.1929.1 Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like (Xanthomonas campestris pv. campestris strain 8004)
MSTERRIAAHAVQGALAPHARIRNVIAVGSGKGGVGKSTTAVNLALALQQHGARVGVLDA
DIYGPSVPAMLGLSGKPDSPDNKSIEPLRAFGIEAMSIGLLVDQDTPMIWRGPMATSALT
QLFNDTLWDDLDYLLIDLPPGTGDIQLTLSQKIPVAGAVIVTTPQDIATLDARKALKMFE
KVEVPVLGIVENMAVHTCSNCGHREHLFGEGGGERMAAQYGVPLLGSLPLDIGIREQGDA
GQPIVIAAPESAAAQAYLAAAARLSEELAKRPRASIPISASLL