Protein Info for Xcc-8004.1880.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR00757: ribonuclease, Rne/Rng family" amino acids 13 to 436 (424 residues), 513.2 bits, see alignment E=2.6e-158 PF10150: RNase_E_G" amino acids 132 to 403 (272 residues), 354.8 bits, see alignment E=3.3e-110 PF20833: RNase_E_G_Thio" amino acids 414 to 496 (83 residues), 34.7 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 100% identity to xcc:XCC2609)

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.-

Use Curated BLAST to search for 3.1.26.- or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7N2 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Xcc-8004.1880.1 Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-) (Xanthomonas campestris pv. campestris strain 8004)
MSEEILVNVTPRETRVAVIENGMLQELHIERGWRRGVVGNIYKGKVQRVMPGMQAAFVEV
GLERAAFLHANDVVRPAPAPASVVDTEETPIPPPPAASVPIVELLRDGQDIVVQVVKDPI
GTKGARLTTQISIPSRYLVLLPQSKVVGVSARIEDEAERLRLKTIVSEVSAQHGGFGYII
RTNAEGQPAEALAEDIAYLSRVWNVVERRGREASACSIIYEDLSLPLRAVRDLIRKDVEK
VKVDSNETFVQLQAFVAKYMPVLAERLELYTGDRPIFDLYGVEDEIGRALDKQVPLKSGG
YLVIDQTEAMTTIDVNTGSFVGQRNLEETVFRTNLEAAQAVARQLRLRNLGGIIIIDFID
MDDPEHRRQVLRTLEKALARDHAKTTVYEFSPLGLVEMTRKRTVESLERQLSETCGQCGG
RGTIKTAETVTYEIFREITRAVRQFDAARLLVIASSKVVARITDEESAAVAELEEFLGKS
IRFQSDDQYLQEQFDVVLL