Protein Info for Xcc-8004.1878.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Protein of unknown function DUF541

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04402: SIMPL" amino acids 39 to 241 (203 residues), 213.2 bits, see alignment E=2.5e-67

Best Hits

KEGG orthology group: K09807, hypothetical protein (inferred from 100% identity to xcb:XC_1505)

Predicted SEED Role

"Protein of unknown function DUF541"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X615 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Xcc-8004.1878.1 Protein of unknown function DUF541 (Xanthomonas campestris pv. campestris strain 8004)
MRTTLKPLLLALSIAAGTAMTAHAQTAPSYTIPNDGTLLNVSAEAEAKRVPDIATVSAGV
VTQAVDGNAAMRQNAEQMSKVMTAVKAAGIADKDVQTSGINLNPQYSYKENEAPKIIGYQ
ASNTVSLKVRDIAKLGKVLDALVAQGANDINGPSFSIDQPEPVYDEARVAALKKARARAE
TYAKSLGLKVRRIVSISEGRNGGGVVPPMMMAASMRSAKAEMDTQVAPGESTLSITLDVT
FELGR