Protein Info for Xcc-8004.1867.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG000875: Thioredoxin domain-containing protein EC-YbbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00085: Thioredoxin" amino acids 7 to 109 (103 residues), 96.9 bits, see alignment E=1.6e-31 TIGR01068: thioredoxin" amino acids 13 to 111 (99 residues), 106.5 bits, see alignment E=3.5e-35 PF13098: Thioredoxin_2" amino acids 26 to 108 (83 residues), 35.1 bits, see alignment E=3.7e-12 PF13905: Thioredoxin_8" amino acids 27 to 70 (44 residues), 27.4 bits, see alignment 9e-10 PF14559: TPR_19" amino acids 135 to 192 (58 residues), 29.6 bits, see alignment E=1.8e-10 PF14561: TPR_20" amino acids 199 to 285 (87 residues), 71.4 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to xcb:XC_1495)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X5K8 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Xcc-8004.1867.1 FIG000875: Thioredoxin domain-containing protein EC-YbbN (Xanthomonas campestris pv. campestris strain 8004)
MSDKAHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFEL
AKVDVDKEQQIAAAFQIRSVPTVFLVKGGELVDGFPGAMPEGQIREFLTQHGVLPAEPQV
AEEVPLAPLDPQAQVAALREAIAAEPDKDELKLDLALALLKTGDTLEAEQLIDALPANLA
TDDRAVRAKARLGFANVLKDAPDAAALQTTVAADGSDLHARHLLGVRHLLDGDDEAALEQ
FLEMLRQNRGFEDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALLF