Protein Info for Xcc-8004.1861.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details PF00892: EamA" amino acids 23 to 148 (126 residues), 74.5 bits, see alignment E=4.7e-25 amino acids 160 to 290 (131 residues), 81.9 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_1491)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X5W8 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Xcc-8004.1861.1 Permease of the drug/metabolite transporter (DMT) superfamily (Xanthomonas campestris pv. campestris strain 8004)
MSAQPSLQPALGVRDWRTPLELVFLGIVWGCSFLFMRVAAPHFGAAALVEIRLALGATVL
LPFLWVARSRFPLHRWPMLAAIGVLNSALPFLLFAWGAQHAPAAVGAICNAMTVLFTALI
AFVFFGERIGTRRAVALLIGFIGVLVLATGKSAGLSVGPAALAGATASLLYGIGYNLVKR
HMGDLPPAASAASTLGCSALLLAPVAWWQWPSAPVPASAWACAGALGVVCTGLAFLMYYR
LIQRIGPARASTVTYLVPVFGALLAWALLGEALTWTMLLAAVLILGSVAFSQRAR