Protein Info for Xcc-8004.1678.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Putative permease often clustered with de novo purine synthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 19 to 47 (29 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 220 to 273 (54 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 316 to 347 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 18 to 348 (331 residues), 204.1 bits, see alignment E=1.7e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_1373)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7A1 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Xcc-8004.1678.1 Putative permease often clustered with de novo purine synthesis (Xanthomonas campestris pv. campestris strain 8004)
MILTPEAEIAQFLRRLKWAAVIVGVLWVVSLLSPILTPFVLALLLAWLGDPLVDRIERAG
RSRNMAVTLVFILMVLLVVLALMILVPMMERQIMTLIDALPQMRDWAIGTAIPWLQRRTG
VELMGWLDPERLIEWIRSHWEQAGGVAKTFFGYVSRSGFAMVTWVINLALLPILAFYFLR
DWDRMVERVAAVIPRAYIGTVSRLALESNDVLGGFIRGQFLVMLALGAIYATGLSIIGLN
LGLLIGIIAGFISFIPYLGATTGIVLALLAAIVQAQGFDLKLLIGVGVVFTVGQLLESYV
LTPRIVGDKIGLHPVAVIFAVMAGGQLFGFLGMLLALPVAAVANVLLRYAHERYTQSDLY
AGERAGIVLQSGPERSVIIDASKDADRS