Protein Info for Xcc-8004.1662.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: RNA polymerase sigma-54 factor RpoN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF00309: Sigma54_AID" amino acids 4 to 48 (45 residues), 66 bits, see alignment 3.1e-22 TIGR02395: RNA polymerase sigma-54 factor" amino acids 10 to 474 (465 residues), 505.7 bits, see alignment E=6.1e-156 PF04963: Sigma54_CBD" amino acids 113 to 305 (193 residues), 184.1 bits, see alignment E=3.5e-58 PF04552: Sigma54_DBD" amino acids 319 to 476 (158 residues), 215.9 bits, see alignment E=4.1e-68

Best Hits

Swiss-Prot: 93% identical to RP54_XANEU: RNA polymerase sigma-54 factor (rpoN) from Xanthomonas euvesicatoria

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 100% identity to xcc:XCC2802)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X757 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Xcc-8004.1662.1 RNA polymerase sigma-54 factor RpoN (Xanthomonas campestris pv. campestris strain 8004)
MKARLQTSLGQQLVMTPQLRQAIKLLQMSTTELEVEIAEAVETNPLLEWADEAAHAASEA
PVEPSPSASNEERQRDEPAPAERDDDWSQDELQWTGTGSGGSFDDDDNGDAAERVAESET
LADHLLWQLHLSPLSPRDRQIGAILIDALDEDGYLREPLSAILETLNLGNVDEAEVLTVL
HQIQRFDPVGIGARSLGECLALQLQVLDAATPARELALQIVAGPLERLPRSGIAGLAHEL
KRSAADVEQAVQLVRSLDPRPGKQISALSQDTYVVPDCVIWRQRGVWRAALAGRAQPKVT
IHRGYEQLIRSCGESDAGYLRGQLQEARWLLKSLEARGETLLRVVRCLLQHQAGFLEFGA
QALRPLTLREIAGELGLHESTISRAIARKYVRTPRGTIPLRSFFASGIDTDSGGEASSTA
IQAMIRRLIDAENPRKPLSDAKLADLLKTSGVPVARRTVAKYREAMNISASHERVRIA