Protein Info for Xcc-8004.1597.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 26 to 150 (125 residues), 33.9 bits, E=4.6e-12
• PF00742: Homoserine_dh
  • amino acids 162 to 357 (196 residues), 150.4 bits, E=4.8e-48

Best Hits

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 99% identity to xca:xccb100_1299)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• aspartate superpathway (21/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A0A0H2X718 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Xcc-8004.1597.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
VSTVLPVSRRAPVAAVTPTPRLALLGTGTVGRAFVTRYTALQQRQLRLPRFDWLANSRIA
HDCGAGAEQALQLANAAPRGRAELQPWAETTALRAGDVLVDATASDVVADWHVEWLTRGV
HVVTANKLGQGTALSRAQDLYAARHASGAYYGDSATVGAGLPLLSSVRALVAGGDQIHSI
EGVLSGSLAWLFHRYDGSTPFSACVREAMAAGYTEPDPRIDLSGEDVRRKLLILARAAGQ
PLEAEQVHVESLVPAALASVAPEAVDAHLETLDALVQTRWQQARAAGRCLRFVGRVDGHG
ASVGLRELALDHPLAGGAGTDNRVAISSDRYRDQPLLIQGPGAGAEVTAAALLDDVLRIV
AG