Protein Info for Xcc-8004.1596.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR02080: O-succinylhomoserine (thiol)-lyase" amino acids 13 to 389 (377 residues), 588.8 bits, see alignment E=1.9e-181 PF01053: Cys_Met_Meta_PP" amino acids 15 to 388 (374 residues), 457.9 bits, see alignment E=3e-141 PF00155: Aminotran_1_2" amino acids 58 to 184 (127 residues), 26.3 bits, see alignment E=6.6e-10 PF00266: Aminotran_5" amino acids 81 to 206 (126 residues), 23.8 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 60% identical to METB_ECOLI: Cystathionine gamma-synthase (metB) from Escherichia coli (strain K12)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 100% identity to xca:xccb100_1298)

MetaCyc: 60% identical to O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (Escherichia coli K-12 substr. MG1655)
4.3.1.-; Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X5E2 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Xcc-8004.1596.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MSFRDPADAPCSAATAAVRAGIDRDTAYGAVTPPIVLSSNFSFDGFGNKRQYDYTRSGNP
TRDLLGEALAELEGGAGGVITSTGMGAINLVLNALLQPGDTLVVPHDAYGGSWRLFNALA
KKGHFALITADLTDPRSLADALAQSPKLVLIETPSNPLLRITDLRFVIEAAHKVGALTVV
DNTFLSPALQKPLEFGADLVLHSTTKYVNGHSDVVGGAVIARDAELHQQLVWWANALGLT
GSPFDAFLTLRGLRTLDARLRVHQENADAIAVLLDEHAAVNQVYFPGLASHPGHALAARQ
QKGFGAMISFELNGGEAAVRAFVDGLRYFTLAESLGGVESLIAHPASMTHAAMTAEARAA
AGISDGLLRLSVGIESAEDLLIDLRAGLARAEAAVSAVARKQVDA