Protein Info for Xcc-8004.1513.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Von Willebrand factor type A domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF12450: vWF_A" amino acids 120 to 212 (93 residues), 133.1 bits, see alignment E=7e-43 PF00092: VWA" amino acids 229 to 394 (166 residues), 66.9 bits, see alignment E=7.1e-22 PF13768: VWA_3" amino acids 229 to 386 (158 residues), 40.4 bits, see alignment E=8.1e-14 PF13519: VWA_2" amino acids 230 to 334 (105 residues), 57.3 bits, see alignment E=5.7e-19 PF12034: YfbK_C" amino acids 405 to 587 (183 residues), 236.6 bits, see alignment E=5.7e-74

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to xcc:XCC2915)

Predicted SEED Role

"Von Willebrand factor type A domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6T6 at UniProt or InterPro

Protein Sequence (597 amino acids)

>Xcc-8004.1513.1 Von Willebrand factor type A domain protein (Xanthomonas campestris pv. campestris strain 8004)
MPRHSLLALALLLGACSSNQPTTPSLTHDAATPREQQPPVADSAANLPLPETSMVAPQVE
SSLRQRAQGNVQASKTASRPMLPAPPVLSTPAAPVPAAALAEPMHMHERLMPMPPSPPTE
NRETYQTLSDNPIVQAAEQPVSTFSIDVDTGSYSNVRRFLNAGTLPPVDAVRVEELINYF
RYDDPAPTDGTPFAVRTELAPTPWNTDTLLLRIGVAGREVPTAALPAANLVFLVDVSGSM
GAPDKLPLLQSSLKLLVRQLRKQDRITLVTYAGSTAVVLPPTSGAQQTRIVEAIDSLQSG
GGTAGASGIELAYKAAQQAYLRGGINRILLATDGDFNVGVTDFDQLKGMVAEKRRSGVAL
STLGFGTGNYNDTLMEQLADAGDGAYAYIDSALEARKVLTHELGSTLATIARDVKIQVEF
NPGTVKEYRLIGYENRALRREDFNNDQVDAGDIGAGHTVTALYEITPAQGAASVDPLRYA
TTAARRPQPTTGNELAHVKLRYKLPEAQRSRLLDTVVRANQQQALAATSDAFRFSAAVAG
FGQRLRGGSQLHGWDYPQLRALAAGSLGSDRHGYRADFLQLLQQADALSSRPLATND