Protein Info for Xcc-8004.1491.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 PF13641: Glyco_tranf_2_3" amino acids 72 to 289 (218 residues), 69 bits, see alignment E=1.1e-22 PF00535: Glycos_transf_2" amino acids 75 to 197 (123 residues), 83.3 bits, see alignment E=4e-27 PF13692: Glyco_trans_1_4" amino acids 527 to 665 (139 residues), 87.7 bits, see alignment E=1.8e-28 PF13524: Glyco_trans_1_2" amino acids 617 to 688 (72 residues), 25.9 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_1219)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X559 at UniProt or InterPro

Protein Sequence (700 amino acids)

>Xcc-8004.1491.1 Glycosyltransferase (Xanthomonas campestris pv. campestris strain 8004)
MSMSLADARYLFNRVLGLIHRSVASMRTRGWRATWQRIRVHTQAPPVALGTPLWLPEAAP
FAAFAVPHSATPQVTVVIPVYNQIAHTLACLRALAAHPPALGIEIVVVDDGSSDATAIDL
PHVQGLHYHQRARNGGFIAACNDGIGLARGDYVVLLNNDTVPQPGWLDRLIGTFTAHPSA
GLVGAQLVYPDGRLQESGGVVFGDGSAWSYGRFESAEDPRYAYVRQMDYCSGAAIALPRA
LLQTLGGLDRRYMPAYYEDTDLAFAVRAAGHSVLVQPASVVVHDEGTSNGTDTRTGVKAY
QVRNRSVFAEKWQQVLQAQLPVGSVPDPASLHRHQRQVLILDECVPQPDRDSGSLRQFNL
IRLLCAEGAHVVFVPTRREHAGRHTQALQQLGVEVWYAPFLEGIGTWLRTHGPRFSAVLL
VRHHVAHACLPLLKRYAPQARTLFDTVDLHYLRERRGAELAGDANLLRSAERTRLRELEI
MAATDVTVLVSAAEQAQLHADAPQIRTALLSNLHEVAGSGQPFAQRRDLVFVGGFRHPPN
VDAVQWFISAIFPLVRAQLPDVVFHCIGADVPAALQLLADETPGVQLHGHVPDLVPYMDT
LRIAVAPLRFGAGVKGKINLSMAHGQPVVGTTCAVEGMHLQDGEDVCVADEADAFAAAIV
RLYQDAALWQRLADNGLRNVAQHFSLDAARATVRTLFIAK