Protein Info for Xcc-8004.1426.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Transmembrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 190 to 216 (27 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF07690: MFS_1" amino acids 7 to 241 (235 residues), 39.5 bits, see alignment E=1.7e-14 amino acids 201 to 377 (177 residues), 48.5 bits, see alignment E=3.1e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_1162)

Predicted SEED Role

"Transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6R6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Xcc-8004.1426.1 Transmembrane transport protein (Xanthomonas campestris pv. campestris strain 8004)
VLRLTALLLGVALLLTGSGLLGTLLAVRGGQAGFDARALGLIMSGYFAGFFLGTFFAPPL
IRRIGHIRAFAFYAALAAIAVLLHPIWLDPWGWGLLRLVTGAALVGLYTVIESWLNAEPD
ARRRSRVFSVYMAINLSALALGQVLLSAGDATAPAMFTLTAILICAAVMPVVTTRLIPPE
VPHVSRLRLVTLYALAPVATIGAGLSGLAMGAFWGLLPVYADRIGLDADGVAMFMLTAIV
GGAVLQWPIGRISDGHDRRIGLVTVSVLAAGIAIAAALPMVQAQTQVLFLLFFVYGGLAF
SLYPFAVAHMLDYLPREDLLSGCSSLLLVHGVGAAIGPALAGGAMQKFGPAALPAYFALM
LLALAGFTLARLLRFQRLRTHPIAFRPMLRTTPSALELMPETDSPSPPHKETH