Protein Info for Xcc-8004.1416.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Glutathione-regulated potassium-efflux system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00005: ABC_tran" amino acids 33 to 194 (162 residues), 78.1 bits, see alignment E=3.2e-25 amino acids 364 to 495 (132 residues), 78.6 bits, see alignment E=2.1e-25 PF12848: ABC_tran_Xtn" amino acids 233 to 313 (81 residues), 84.5 bits, see alignment E=1.3e-27 PF13304: AAA_21" amino acids 450 to 525 (76 residues), 29.7 bits, see alignment E=2.2e-10 PF16326: ABC_tran_CTD" amino acids 592 to 650 (59 residues), 37.8 bits, see alignment 5.6e-13

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 99% identity to xca:xccb100_1153)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6M0 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Xcc-8004.1416.1 Glutathione-regulated potassium-efflux system ATP-binding protein (Xanthomonas campestris pv. campestris strain 8004)
MLLICSFLFVLSDCPSMISLRNFSMRRGERLLLSNVDLTMHAGYRVGVVGRNGTGKSSLF
AAVKGELEADKGDVDLPGKVRTASVSQETPSLPDPALSFVLGGDIEVSAILQKEAEATAR
EDWEAVANAHQTMAELGAYDAEARAGKLLHGLGFPADTHHRAVSSFSGGWRVRLNLARAL
MMPSDLLLLDEPTNHLDMDAVLWLEQWLLKYPGTLLLISHDREFLDNVATHTLHLHGGTA
KLYVGGYTDFERQRIEHLRQQQIAHDKEQAERAHLQSFIDRFKAQASKATQAQSRMKRLA
KMAGTEAVRAEREFRIQFAQPNRLPFSLIRLNHLDAGYAASPRESGIGDGESQKRGSSDA
ITVLHDVGFGLEAGDRIGLLGPNGAGKSTLVKTLVGELAPLSGERSAHPDLRIGYFAQHT
VESLHEGQSPMDHFRDLSPDGSNQAFRDFLGKWNFAGDRAFEVVDGFSGGERARLALALI
AWQQPNVLLLDEPTNHLDLEMREALAEALSDFEGAIVMVSHDRHLIGLVCDSFWRVADGV
VEPFDGDLDEYAAWLRSRPAAQGTKQKMAEVAPTPPPPTKPLPPKKAVNPHRLASAEKRV
GELEAALADLDRQLANPANYPDADKTAVLGRERETTAQQLAAAEAAWMELLDGA