Protein Info for Xcc-8004.1410.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: putative cytochrome P450 hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00067: p450" amino acids 114 to 401 (288 residues), 89.3 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 52% identical to C1332_XYLFT: Putative cytochrome P450 133B2 (cyp133B2) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K00517, [EC: 1.14.-.-] (inferred from 100% identity to xca:xccb100_1148)

Predicted SEED Role

"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6L5 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Xcc-8004.1410.1 putative cytochrome P450 hydroxylase (Xanthomonas campestris pv. campestris strain 8004)
MRTQHWARSMCAAPGRTRAIPPSRLRRQALHGTTMQLSDFATPAFRQDPYPMYARLRAAG
PLVQISDNGWVSGHYTVVDALLSDRRVGRNYLDSIRVRYGANAAEMPLFQGMSRMFLLLN
PPVHTQQRALMTKAFGARQLEALREVAVDTADALLDQHEDRRSCDLLNDFAMPMTISLIC
RMLGLAVTDVAALGQASSALAKVFDPLMRPEDMAQATAAYTTLEQYFRAIVLQRRDTQED
DLIARLIAAEDHGQRMPVDDIVSNVIMLFTAGHETTANMICNALIALHRHPEQLQLLRDT
PTLMPNAVLECMRYDSSVQVAMRSVLQPLQVEGTTLPVGAILYLMLGSANHDAEQFTAPQ
QLDLRRQQGRALSFGGGVHHCLGNRLALIELETALERLLQRAPALRLPELDNLSWNERAN
LRGIQALHATW