Protein Info for Xcc-8004.1361.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 12 to 258 (247 residues), 263.7 bits, see alignment E=7.2e-83 PF13512: TPR_18" amino acids 33 to 177 (145 residues), 134.2 bits, see alignment E=8.3e-43 PF13525: YfiO" amino acids 40 to 244 (205 residues), 191.8 bits, see alignment E=2.6e-60 PF13432: TPR_16" amino acids 46 to 110 (65 residues), 25.3 bits, see alignment E=3.6e-09 PF13174: TPR_6" amino acids 52 to 73 (22 residues), 13.2 bits, see alignment (E = 2.4e-05)

Best Hits

Swiss-Prot: 76% identical to BAMD_XYLFA: Outer membrane protein assembly factor BamD (bamD) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to xca:xccb100_1102)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6H9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Xcc-8004.1361.1 Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB) (Xanthomonas campestris pv. campestris strain 8004)
MIRRSTFSAPARLIALMLVMAFVVTGCHRGAKDKNPDEGMPVEQLYGKGHGLMEKGNWAG
AEASYKRLIAQYPYGPYTEQAMIETAYAQYKAGKHDDTVSSVDRFIRTYPTHRNISYLYY
LRGLANSNRDTVFLRRVWSLDPSRRDLSSPQQAYNDFNTVTDRYPNSRYAPDARKRMIEL
RDIFAQHELDNALYYLRRDAWVSAAGRANYLLETYPQSAFQYDAVAVLAEAYTHLGNKTL
AADARRVLELNSPQHPWLTGDWPKYPWAVRKLNPFAGEKSAATGQRNAQMSRD