Protein Info for Xcc-8004.1336.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: two-component system sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 21 to 24 (4 residues), see Phobius details transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details PF00512: HisKA" amino acids 237 to 301 (65 residues), 66.6 bits, see alignment E=1.7e-22 PF02518: HATPase_c" amino acids 344 to 440 (97 residues), 63.4 bits, see alignment E=2.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_1082)

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6K1 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Xcc-8004.1336.1 two-component system sensor protein (Xanthomonas campestris pv. campestris strain 8004)
MPESSSGTRPARRRGRYRRRLRSRIILSFVLLGFCLTTLFAFATTWARSRVENQLVEDVM
NRNIDAFAQRFYSDPLRNPDLPVQQMRGRVVKSDKFEALRREQPEWYQLRDGIHTISGVD
EGGNAYSYKLAVRKTPSEWFFLAYDMTQTLKGEIQLKRTLTLSVLVFSGLSLLIGWWSAS
KVMRPVSDLAARLRAYRGGTSEPKPLAAHFPDDEVGQLAEALDDYSARLTEVVQRDREFN
ADVSHELRTPLAVIRGATELLLTKPNLDEKVLQRLQRIQRAEQQCSDLIGSLLLLSRNER
GQGSSNVAKVAEQLIDSHRAQLGGKPLELLLEGVRDLVIDAPESALSVALGNLIGNAVKY
TQDGQVRVRVLADAVEVIDSGPGLSEEDAAKLFQRGYRGTHAGHSQGGGIGLSIVSRLCD
LYGWRVSVRPGQERGVIATLAFHR