Protein Info for Xcc-8004.1287.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Phospholipase/lecithinase/hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 33 to 296 (264 residues), 73 bits, see alignment E=3.9e-24 PF03797: Autotransporter" amino acids 342 to 573 (232 residues), 151.4 bits, see alignment E=4.2e-48

Best Hits

KEGG orthology group: K12686, outer membrane lipase/esterase (inferred from 99% identity to xca:xccb100_1030)

Predicted SEED Role

"Phospholipase/lecithinase/hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6D5 at UniProt or InterPro

Protein Sequence (605 amino acids)

>Xcc-8004.1287.1 Phospholipase/lecithinase/hemolysin (Xanthomonas campestris pv. campestris strain 8004)
MASTLRPIRSLMAVAIALAASPAMADSAFDQTVFFGDSLTDSGYYNPLLPAASRAVTGKF
TTNPGWVWAEYVGDHFGTNAAPNGNGQTGDNYAAGGARIQASSVSALGAAPSVTSQVNTY
LVANGGQANPNALYTVWGGANDLLAAATAPAQAQAIIGSAVTAQVGAVGALQAAGARYVM
VPTIPDVGITPRFRAGGAAAMAQGTAAATAYNTALFNGLQSAGLRVIPVDTFHILQEVVA
DPGIYGFSNVTGTACNPALALPACNPTSLVAANAPNTYVFADGIHPTTATHQILGQYAIS
LLEAPRLQQVLTRSAQAGGRARADQVAWHLDGKPEADGLRWWGSVRGDIQRYDDADLYDG
MAPAGLFGVDWTAGDLVFGGFAGFGRMDADFGNRNGSFKQDDTTLGGFVGWYTGPVWVNA
QVSYSWLSYDVDREVQLGPATRVHSGSPDGSNLTAAVNAGYSLGEGNVKYGPVVGLTWQK
LKLDGYTESNASSTALGYADQDIDSLVGRIGFQVRLDGAPVKPYLQATYDHEFKDGTEAS
AWLQSMPEVGMYTVPGQNFDRNYATVVLGARTGIWGLQSNIGLSTTTAQRSARDATVFVN
FSGNF