Protein Info for Xcc-8004.1265.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: sodium/alanine symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 415 to 431 (17 residues), see Phobius details amino acids 436 to 459 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 469 (457 residues), 469.2 bits, see alignment E=6.3e-145 PF01235: Na_Ala_symp" amino acids 51 to 481 (431 residues), 520.3 bits, see alignment E=2.1e-160

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to xca:xccb100_1011)

Predicted SEED Role

"sodium/alanine symporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6C1 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Xcc-8004.1265.1 sodium/alanine symporter family protein (Xanthomonas campestris pv. campestris strain 8004)
VEALINGINGIVWSKALIFMCLGAGVYFTIRTRFMQVRGFVEMVRLTVGGQKSDAGVSSF
QALAMSMAGRIGIGNIAGVATAIAFGGPGAIFWMWVMGFLGASTSYVESTLAQIYKIKDA
DGRYRGGPAYYIEKAMGLKWYALTFAVATIIATGFLMPGVQANAIADSAINACRGTSLCG
AMDGQWMGLPMRDAAKLGIGILVACMLAVIIFGGVKRIANFAEVVVPFMAMGYILMALVI
MVLNAERVPDMFATIFSSAFGSHAAFGALLGLAVEWGVKRGIYANEAGQGTGPHAAAAAE
VSHPAKQGYVQAFAIYFDTMMVCTATAFLILTTGKYNVYSPDGAKPGLYAGLVGVEEGPG
YAQAAVESVLPGWGAGFVAIALFFFAFTTIMAYYYMAETNLSYINGNRRRPLTVLLLRLG
ILGMVIFGAFHNAQLAWALGDIGVGVMAWLNIIAILILHKPAMLALKDYERQKRQGLDPV
FDPVSLGIKNADFWTQR