Protein Info for Xcc-8004.1204.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: ATP-dependent DNA helicase RecG (EC 3.6.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 PF17191: RecG_wedge" amino acids 24 to 180 (157 residues), 36.4 bits, see alignment E=1.2e-12 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 37 to 682 (646 residues), 695.3 bits, see alignment E=4.6e-213 PF01336: tRNA_anti-codon" amino acids 71 to 145 (75 residues), 30 bits, see alignment E=1.2e-10 PF04851: ResIII" amino acids 279 to 440 (162 residues), 29 bits, see alignment E=2.8e-10 PF00270: DEAD" amino acids 282 to 445 (164 residues), 75.2 bits, see alignment E=1.7e-24 PF00271: Helicase_C" amino acids 528 to 607 (80 residues), 66.4 bits, see alignment E=7.7e-22 PF19833: RecG_dom3_C" amino acids 636 to 695 (60 residues), 54.3 bits, see alignment 3.7e-18

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to xcb:XC_0947)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6C2 at UniProt or InterPro

Protein Sequence (713 amino acids)

>Xcc-8004.1204.1 ATP-dependent DNA helicase RecG (EC 3.6.1.-) (Xanthomonas campestris pv. campestris strain 8004)
VPRARSVTPSLAVAGQAPLSSLPGVGPKVAEKFAARGILSLQDLWLHLPLRYEDRTRLTT
IAQLQGGVPAQIEGRVEAMERGFRFRPVLRVAMSDDSCGTLVLRFFHFRAAQVAQFSPGT
RLRVFGTPKPGQNGWEIVHPSYRVLAPDEDAGLGDCLDPVYPVLEGVGPATLRKLIGQAL
ERLPPEAALELLPPHWLQDEQLPSLRSALLTMHRPPVDTDPQQLLAGGHPAQQRLAIEEL
LAHQVSLRRQRIALQRFRAPQLRGGRLVQQLRKALPFQLTGAQQRVFEQIAHDLAQPAPM
LRLVQGDVGSGKTVVAALAAMLAVEHGKQVALAAPTELLAEQHLANLRGWLEPLGVRIVW
LAGKVTGKARVAAMAEVASGQAQVVVGTHALMQDAVVFHDLALAIIDEQHRFGVHQRLAL
RDKGAAAGSVPHQLVMTATPIPRTLAMAAYADLHVSAIDELPPGRTPVQTIVLSAERRPE
LVERIRAACAEGRQAYWVCTLIEESEDTDKGAQNGPPRIEAQAAQVTFETLSAQLPGVRV
ALVHGRMKPAEKQQAMLDFKQGRTDLLVATTVIEVGVDVPNASLMIIENAERLGLAQLHQ
LRGRVGRGAAASSCVLLYQGPLSLMARQRLETMRQTNDGFVIAERDLELRGPGELLGTRQ
TGLASFRIADLARDAGLLPRVQVLAERLLDEAPEIADRVVARWIGGAVRYAAA