Protein Info for Xcc-8004.1202.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01197: Ribosomal_L31
  • amino acids 1 to 79 (79 residues), 92.7 bits, E=6.6e-31
• TIGR00105: ribosomal protein bL31
  • amino acids 1 to 79 (79 residues), 69.3 bits, E=1.1e-23

Best Hits

Swiss-Prot: 100% identical to RL31B_XANCP: 50S ribosomal protein L31 type B (rpmE2) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 100% identity to xcc:XCC3236)

Predicted SEED Role

"LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent"

Sequence Analysis Tools

See Q4UY54 at UniProt or InterPro

Protein Sequence (80 amino acids)

>Xcc-8004.1202.1 LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent (Xanthomonas campestris pv. campestris strain 8004)
MKDNVHPSYNDVVFHDVTSDFKILTRSTMSSKETVKWEDGQDYPLIKVEISSASHPFYTG
KHKVIDTGGRIDKFQKRYAR