Protein Info for Xcc-8004.1184.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: TPR domain protein in aerotolerance operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 306 to 322 (17 residues), see Phobius details PF00092: VWA" amino acids 99 to 247 (149 residues), 31.2 bits, see alignment E=8.6e-11 PF13519: VWA_2" amino acids 99 to 206 (108 residues), 38.6 bits, see alignment E=5.1e-13 PF13432: TPR_16" amino acids 362 to 418 (57 residues), 34.2 bits, see alignment 1.1e-11 PF00515: TPR_1" amino acids 388 to 418 (31 residues), 38.8 bits, see alignment (E = 1.9e-13) PF13181: TPR_8" amino acids 388 to 418 (31 residues), 24 bits, see alignment (E = 1e-08) PF13428: TPR_14" amino acids 388 to 427 (40 residues), 27.8 bits, see alignment 9.8e-10 PF07719: TPR_2" amino acids 388 to 418 (31 residues), 35.9 bits, see alignment (E = 1.6e-12)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to xcc:XCC3223)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X4X3 at UniProt or InterPro

Protein Sequence (602 amino acids)

>Xcc-8004.1184.1 TPR domain protein in aerotolerance operon (Xanthomonas campestris pv. campestris strain 8004)
MNTLSTALHTLHLLRPQLLWALVLIVPAAVLWFLRQRDADVWRQSVDAHLLPQLLVTGGR
RGWFGFVLAVVAYSVAVVAMSGPSWRQTERPVYQSNRPLVVALDLSSSINANDLPPSRLL
QARAKLATLLRERAGGDVALLAYAGESFTVAPLTEDAANVALFLDALSPSVMPVDGKRAD
RAIEAAVQLLSQAGFKQGDILVMSDSADESAESAARVARSRGFNVSTLGVGSAHGAVYRA
ASGEIAQARLDEASLRDLASQGGGRYAPLAADDADLRALGVLDPAQQPAADAAAAANGSK
TWLDEGYWLLFPVMALALLAFRRRAAVMVLALLCVGPFVQPAQAAEGTLWQRADQVQQQR
LDAGVQAYRKGDFAAAQKAFEAVPTDQGWYNLGNALARQGRYDDAIAAYDRALRQQPQLQ
DAIANRAAVEAARKRQQQNKDGKGKPQQDQNKGDKQQDQNKDGQGKPEQTAGKDGKDGKG
GQDGKPSSQPPKDGQTPGQPSPARQGEQKQPDSPPQTPDAQAQQQADAAQRRKMEQAMAQ
AGAKGVPSKEQQAAAAAAAETPEQREQRQAVDAWIRRVPDDPGSLLRAKFRLEHERRQRD
GQ