Protein Info for Xcc-8004.109.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: L-Proline/Glycine betaine transporter ProP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 428 to 445 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 40 to 249 (210 residues), 113.5 bits, see alignment E=1.3e-36 amino acids 250 to 454 (205 residues), 66.6 bits, see alignment E=2e-22 PF07690: MFS_1" amino acids 43 to 401 (359 residues), 114.4 bits, see alignment E=5.8e-37

Best Hits

Swiss-Prot: 55% identical to OUSA_DICD3: Glycine betaine/proline/ectoine/pipecolic acid transporter OusA (ousA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to xcc:XCC0083)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X2M7 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Xcc-8004.109.1 L-Proline/Glycine betaine transporter ProP (Xanthomonas campestris pv. campestris strain 8004)
MHDTRAIRSHFGWFKRRRQLQLDEVTVVDRGMLRKAVGAAALGNAMEWFDFGVYGYLAVT
LGQVFFPSSSPTAQLIATFATFTVAFLVRPIGGMVFGPLGDRYGRQKVLAATMILMALGT
FSIGLIPSYAQIGLWAPALLLLARLLQGFSTGGEYGGAATFIAEYATDRNRGLMGSWLEF
GTLGGYIAGAATVTALHMALSQAQMLDWGWRVPFLVAGPLGLLGLYMRMKLEETPAFRAY
TEQSEQRERETAGQGLMTLLRLHWPQLLKCVGLVLVFNVTDYMLLTYMPSYLSVTMGYAE
SKGLLLIILVMLVMMPLNVVGGMFSDKLGRRPMIIGACAALFALAIPCLLLIGSGSDVLI
FTGLMLLGLALVCFTSSMPSTLPALFYTPVRYSALSIAFNVSVSLFGGTTPLVTAWLVER
TGDPLVPAYYLMGAAAIGLVTMLFVRETAGLPLRGSPPAVASDAEARALLQGDSPVTVDA
QLPLSGTPSIGQPRPA