Protein Info for Xcc-8004.1060.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Ketol-acid reductoisomerase (EC 1.1.1.86)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00465: ketol-acid reductoisomerase
  • amino acids 8 to 316 (309 residues), 419 bits, E=5.1e-130
• PF03446: NAD_binding_2
  • amino acids 8 to 93 (86 residues), 23.6 bits, E=9.6e-09
• PF03807: F420_oxidored
  • amino acids 8 to 82 (75 residues), 24.6 bits, E=6.2e-09
• PF07991: IlvN
  • amino acids 8 to 166 (159 residues), 234.8 bits, E=8.3e-74
• PF01450: IlvC
  • amino acids 173 to 316 (144 residues), 207.8 bits, E=1.7e-65

Best Hits

Swiss-Prot: 100% identical to ILVC_XANC8: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 100% identity to xca:xccb100_0874)

MetaCyc: 57% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

See Q4UYF7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Xcc-8004.1060.1 Ketol-acid reductoisomerase (EC 1.1.1.86) (Xanthomonas campestris pv. campestris strain 8004)
MSNDTQPTIAIIGYGSQGRAHALNLRDSGFDVTVGLRPGGPTEAKAQADGFTVVAPAEAV
KTADLVAVLTPDMVQKKLYEEVIAPNMKQGACLLFAHGLNVHFDMIKPRADLDVVLVAPK
GPGALVRREYEIGRGVPCIYAVYQDTSGKAEQFALTYAGGLGGARANIIKTTFKEETETD
LFGEQAVLCGGASSLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLEFV
SETAQYGDYVSGPRVIDASTKARMKDVLTDIQNGTFTKNWVAEYEAGLPNYTKFKQADLE
HPIEEVGKKLRAKMVWLNGEQQAAATPAKQQAA