Protein Info for Xcc-8004.1034.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 231 to 257 (27 residues), see Phobius details amino acids 319 to 348 (30 residues), see Phobius details amino acids 357 to 385 (29 residues), see Phobius details PF00375: SDF" amino acids 20 to 412 (393 residues), 367 bits, see alignment E=6e-114

Best Hits

Swiss-Prot: 100% identical to DCTA_XANCB: C4-dicarboxylate transport protein (dctA) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to xca:xccb100_0852)

MetaCyc: 59% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UYH8 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Xcc-8004.1034.1 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate (Xanthomonas campestris pv. campestris strain 8004)
MHISKPAGPLPAPVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII
APVIFLTIVTGIAGMTHLKTVGRVFAKSMTYFLFFSTLALIVGMVVAHVVQPGAGMNINP
AELDQSAVNTYVQKSHELSLVGFLMDIIPATLISAFVDGNILQVLFVAVLFGIALALVGE
RGRPVLSFLEALTAPVFRLVHMLMKAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLT
SLFFVLVILGIVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSV
VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNVDLTLGQQITLLAVAMLSSKGAAGVTGA
GFITLAATLSVVPDVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDQ
LSLALDGRAPPLQAPVPPPDAVAPVSAR