Protein Info for Xcc-8004.1027.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Two-component system sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details PF08521: 2CSK_N" amino acids 24 to 165 (142 residues), 134.1 bits, see alignment E=7.5e-43 PF00512: HisKA" amino acids 243 to 301 (59 residues), 43.9 bits, see alignment E=4.1e-15 PF02518: HATPase_c" amino acids 352 to 457 (106 residues), 87.2 bits, see alignment E=2.1e-28 PF13581: HATPase_c_2" amino acids 355 to 435 (81 residues), 33.5 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 100% identity to xcc:XCC3351)

Predicted SEED Role

"Two-component system sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X606 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Xcc-8004.1027.1 Two-component system sensor protein (Xanthomonas campestris pv. campestris strain 8004)
MAEAHAVAPSIRRTLLLYLSSLSLLGAVVLFFAARDYGERAANRSYDHLLVSSALSIIDS
VALVGGDWQVDLPYASLDLLGMAPEDRVFYRVFDAQGRTITGEDTLPLPPRAPDGERPLL
FDATYSGEPVRFAVVMHRVASDSGQGEVRVQVGQTRRARDAVARDVVLNALVAIAVLSLL
ALALVWIGVYRALRPLQRIERDLSRREPSDLKPLTVPAPQEMQLMVAALNRFMARLSSSN
ETLRAFMAEAAHQMRTPLAALRAQAQLAMDDDDPRDMQRSLVAIERNASHMSRLLNQLLS
DASVIHRANLQRFATVDLVELLHQALHDALPRGEEAPRVHLAIDPQPALLRGDALLLREA
LKNLIDNACKYGAGAPLQVALTSDGHQHVLTIADHGPGIPPAEAERVFERFVRGPDAPAG
GAGLGLAIVKRVVEAHGGRIDLSNRIGGGLIASLHFPGGMA