Protein Info for Xcc-8004.10.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: TPR domain protein, putative component of TonB system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13181: TPR_8" amino acids 112 to 137 (26 residues), 12.2 bits, see alignment (E = 9e-05) amino acids 184 to 212 (29 residues), 15.2 bits, see alignment (E = 1e-05) PF09295: ChAPs" amino acids 144 to 251 (108 residues), 23.5 bits, see alignment E=1.3e-08 PF13432: TPR_16" amino acids 186 to 221 (36 residues), 17.9 bits, see alignment 1.8e-06 amino acids 225 to 276 (52 residues), 21 bits, see alignment 2e-07 PF14559: TPR_19" amino acids 226 to 281 (56 residues), 27.5 bits, see alignment 1.7e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_0007)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X3P7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Xcc-8004.10.1 TPR domain protein, putative component of TonB system (Xanthomonas campestris pv. campestris strain 8004)
MKLLNRKHALLSLIIAASLGGAVVTDAVAQSDRSTERANRKSKNSGKAEELYPQSTRTAP
TIKPSSKLGSKLQKLIETFNKGEDFPAVRAQADEILANSAANEADKALAGQLAAQAAYNM
DDTAAAKTYLQQAIALNALDNNGQFQSMLMLAQLQLQDDQQAEGLATLDKYLDESKSQRP
EDLILKGQALYQAERYKEAIPVLKQAIAASPEPKDTWNQLLMASYAEAGQTGEAVAAAEA
LAAKTPNDKKAQLNLASMYMQADQMDKAAGVMDKLRASGQLTEEKEYKQLYSIYANTENK
EKDVIAVITEGMQKGILKPDYQTYLALAQSYYYSEDVPKAIENWQKAAPLSKDGETYLNL
AKVLHSEGRIPEAKQAAQQAIAKGVKKPEDAKKIINLK