Protein Info for TX73_025080 in Rhodopseudomonas palustris CGA009

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 19 to 468 (450 residues), 499 bits, see alignment E=1.3e-153 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 19 to 614 (596 residues), 804.7 bits, see alignment E=4.8e-246 PF00270: DEAD" amino acids 33 to 189 (157 residues), 75.8 bits, see alignment E=9e-25 PF00271: Helicase_C" amino acids 230 to 336 (107 residues), 66.6 bits, see alignment E=5.9e-22 PF16124: RecQ_Zn_bind" amino acids 348 to 411 (64 residues), 75.1 bits, see alignment E=1.5e-24 PF09382: RQC" amino acids 413 to 522 (110 residues), 131.1 bits, see alignment E=4.3e-42 PF00570: HRDC" amino acids 546 to 612 (67 residues), 80.1 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to rpa:RPA4826)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (616 amino acids)

>TX73_025080 DNA helicase RecQ (Rhodopseudomonas palustris CGA009)
MIAPVSRHTDDDLDARALSVLNHVFGLPSFRGQQEAIVRHVADGGDALVLMPTGGGKSLC
YQLPALLREGCGVVVSPLIALMRDQVAGLLESGVRAAALNSTLSYDEANDIEQQLLKGEL
DLLYVAPERLLTPRCLSLLARAKISLFAIDEAHCVSQWGHDFRPEYVGLSAIAEKFPNVP
RIALTATADALTRREIAERLSLTDAPCFVSSFDRPNIRYSIVDKQNAPAQLKAFIDDRHR
GHSGVVYCLSRAKVEDIAETLSKSGLTALPYHAGLPPDVRARNQDRFLNEDGIVIVATIA
FGMGIDKPDVRFVAHLDLPKSIEAYYQETGRAGRDGKPSEAWMAYGLSDIVQQRRMIDES
SGSDAFKRVSMGKLDALVGLCESTGCRRTRLLGYFGETAQHESCGNCDNCLTPPKVIDGT
VPAQKLLSCAYRTGQRFGAQHLIDVLLGRLTDRVTQFGHDKLSVFGIGGEFGEKQWRAVI
RQLVSLGHLAPDSEAFGALKLTETSRAVLKGETQVMLREQTGRPPRAKSRRGDLVGGAQR
ETSGDPALFAALKAWRSEVAKARGVPAYVVLHDATLDGLAAAKPRTLDELRGIAGIGDKK
LDHYGAALLAVIGERR