Protein Info for TX73_025000 in Rhodopseudomonas palustris CGA009

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 821 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 241 to 264 (24 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 411 to 437 (27 residues), see Phobius details amino acids 458 to 480 (23 residues), see Phobius details amino acids 687 to 710 (24 residues), see Phobius details amino acids 739 to 765 (27 residues), see Phobius details amino acids 784 to 803 (20 residues), see Phobius details PF02687: FtsX" amino acids 243 to 367 (125 residues), 49.2 bits, see alignment E=5.1e-17 amino acids 692 to 810 (119 residues), 39.3 bits, see alignment E=6.1e-14 PF12704: MacB_PCD" amino acids 463 to 644 (182 residues), 35.9 bits, see alignment E=9.8e-13

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to rpa:RPA4810)

Predicted SEED Role

"AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (821 amino acids)

>TX73_025000 FtsX-like permease family protein (Rhodopseudomonas palustris CGA009)
MRRALWILAVLLSHWRRHPTQLATLAIGLISATALWSGVQALNAQARTSYDRAAAALGGN
RTATLVARDGGSFSQQLYVDLRRAGWQVSPAVEGAIRISGRSLRLLGVEPLSLPVEARTA
PALGTGDLQGFILPPGQTLIAPETLRDFSLAEGATPELPNGQHLPPLKPQAEIAPGVLVV
DIGIAQQLLDMPHRLSRLLLGNKPSGSRPPLRDIVGDKLQLDQPDAATELERLTDSFHLN
LTAFGLLSFLVGLFIVNSAIGLAFEQRRPMLRTLRACGASARQLNAVMVIELCLIALLAG
LIGLVCGYLIAATLLPDVAATLRGLYGAQIPGELSLRPQWWLAGIAISILGTLAAASTAL
IKAARLPVLVAAQPYAWQQAQYRWLLVQGVAALAVFAAGFGFLWFGDSLLSGFAVLAAIL
LGAALGLPAILGLVLALGEKLARGPLTSWFWADSRLQLSGLSLALMALLLALGVNVGVGT
MVESFSRTFQRWLDGRLAAEVYLNAATDQQATEIKAWLKGRPEVTSLLPGARAEVKLQGQ
PVELIGFADDATYRDHWPLLEHTKDVWDRVARGDAALVSEQLWRRLGVKLGDRIVVPSDR
GPWPVEVVGIYADYGNPRGQLGIAFGALVTHFPDVAKTRFGLRVDPARVPALIADLRNSF
ALGERSLADQSTLKAISKQIFSRTFAVTTALNAFTLGIAGVALLTSLLTLGASRLPQLAP
LWAIGITRRRLALIELMKTLAMAAITALLALPLGLLVAWCLIAVVNVKAFGWRLPFEVFP
IELAKLVGIALLATVLAAALPILKLMRMQPARLVKVFADER