Protein Info for TX73_024930 in Rhodopseudomonas palustris CGA009

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 46 to 262 (217 residues), 109.3 bits, E=1.1e-35

Best Hits

Swiss-Prot: 54% identical to AAPJ_RHIL3: General L-amino acid-binding periplasmic protein AapJ (aapJ) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 99% identity to rpt:Rpal_5283)

Predicted SEED Role

"extracellular solute-binding protein, family 3"

Protein Sequence (344 amino acids)

>TX73_024930 amino acid ABC transporter substrate-binding protein (Rhodopseudomonas palustris CGA009)
MFKRTFRTGLAIGLVVAAGIAAAAITYERYDTKTLKRTIRRDAVLCGVNKGLPGFSTPDD
KGNWTGFDVDFCRAVAAAIFDDPTKVQFVPLDANERFKELQSRKVDILSRNSTWSMSRET
NYDLYFPAVAYYDGQGFMVPASRKIDSAVELDGSKVCVQNGTTTQLNLADYFRANNMKYQ
EVKSEKFDDVVKAYKDGQCDTFTADVSQLYALRKTFEKSGDHIILPDVISKEPLAPVVRQ
RDDDWMMIVKWTLYAMINAEELGITSQNIGEALKSKKPDVMRLVGTEGAFGEDLGLSKDW
AARIIRHVGNYGEVYDRNVGKLGIPRGLNQLWSNGGIQYAPPIR